PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pavir.1NG065500.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Panicinae; Panicum
Family MIKC_MADS
Protein Properties Length: 259aa    MW: 28893.8 Da    PI: 6.5094
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pavir.1NG065500.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF87.95.5e-28959151
                         S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
               SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
                         krien++nrqvtfskRr g+lKKA+EL vLCda+v v+ifsstgk++ey+s
  Pavir.1NG065500.1.p  9 KRIENSTNRQVTFSKRRGGLLKKANELAVLCDARVGVVIFSSTGKMFEYCS 59
                         79***********************************************96 PP

2K-box74.43.3e-25711711100
                K-box   1 yqkssgks.leeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqe 89 
                          yq++++++  e ++ ++   e++++k+e+++L++ +R++ G+dL+sL+l ++  LeqqLe +++k+R++K++ll +q+++l++ke+ l++
  Pavir.1NG065500.1.p  71 YQHATNTHfEEINQDQQIFVEMTRMKNEMDQLETGIRRYTGDDLSSLTLDDISDLEQQLEYAVSKVRARKHQLLNQQLDNLRRKEHILED 160
                          56666666667788899999********************************************************************** PP

                K-box  90 enkaLrkklee 100
                          +n+ L ++++e
  Pavir.1NG065500.1.p 161 QNTFLYRMINE 171
                          *****999875 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004321.5E-41160IPR002100Transcription factor, MADS-box
PROSITE profilePS5006632.226161IPR002100Transcription factor, MADS-box
CDDcd002651.07E-42278No hitNo description
SuperFamilySSF554551.57E-32286IPR002100Transcription factor, MADS-box
PROSITE patternPS003500357IPR002100Transcription factor, MADS-box
PRINTSPR004042.9E-29323IPR002100Transcription factor, MADS-box
PfamPF003191.4E-251057IPR002100Transcription factor, MADS-box
PRINTSPR004042.9E-292338IPR002100Transcription factor, MADS-box
PRINTSPR004042.9E-293859IPR002100Transcription factor, MADS-box
PfamPF014862.9E-2481169IPR002487Transcription factor, K-box
PROSITE profilePS5129714.66985175IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 259 aa     Download sequence    Send to blast
MGRGKIEIKR IENSTNRQVT FSKRRGGLLK KANELAVLCD ARVGVVIFSS TGKMFEYCSP  60
ACSLKELIEQ YQHATNTHFE EINQDQQIFV EMTRMKNEMD QLETGIRRYT GDDLSSLTLD  120
DISDLEQQLE YAVSKVRARK HQLLNQQLDN LRRKEHILED QNTFLYRMIN ENQQAAALGG  180
EVKLGEMAPL AMLPAPAPAP FAPHSGCYYG GESSSTALQL TPAAPQLHPD VGFRLQPTQP  240
NLQDPACGGL HGHGLQLW*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1tqe_S7e-18185183Myocyte-specific enhancer factor 2B
1tqe_R7e-18185183Myocyte-specific enhancer factor 2B
1tqe_Q7e-18185183Myocyte-specific enhancer factor 2B
1tqe_P7e-18185183Myocyte-specific enhancer factor 2B
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAJ2712080.0AJ271208.1 Zea mays mRNA for putative MADS-domain transcription factor (m17 gene).
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004951767.11e-169PREDICTED: MADS-box protein ZMM17
SwissprotQ8VWM81e-164M17_MAIZE; MADS-box protein ZMM17
TrEMBLK3YV871e-169K3YV87_SETIT; Uncharacterized protein
STRINGSi018183m1e-169(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP185037100
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G23260.24e-44MIKC_MADS family protein